PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10026757m
Common NameEUTSA_v10026757mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 222aa    MW: 25411.1 Da    PI: 7.3521
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10026757mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.29.1e-28959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     k+i+n + rqvtfskRr gi+KKA ELS+LCda+va+iifs tgkl+e+ss
  Thhalv10026757m  9 KKIDNITARQVTFSKRRRGIFKKADELSILCDADVALIIFSATGKLFEFSS 59
                     68***********************************************96 PP

2K-box60.28.2e-21841711198
            K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      + +++  + +l++L k ie   +++R+l GedLe L+l+eLq+Le+ Le++l+++ +kK e +++qi+ l k+  el +en++Lr+kl
  Thhalv10026757m  84 SLNHQPENCNLSRLSKDIEDKTKQLRKLRGEDLEGLNLEELQRLEKLLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREKL 171
                      56788888899***************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.3E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.408161IPR002100Transcription factor, MADS-box
CDDcd002653.97E-36269No hitNo description
SuperFamilySSF554551.19E-29372IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.40687177IPR002487Transcription factor, K-box
PfamPF014865.0E-1887171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009739Biological Processresponse to gibberellin
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010220Biological Processpositive regulation of vernalization response
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MAREKIRIKK IDNITARQVT FSKRRRGIFK KADELSILCD ADVALIIFSA TGKLFEFSSS  60
RMRDILGRYN LHASNIDKLM DQPSLNHQPE NCNLSRLSKD IEDKTKQLRK LRGEDLEGLN  120
LEELQRLEKL LESGLSRVSE KKGECVMSQI SSLEKRGSEL VDENRRLREK LVTLERAKMM  180
AFKEAMETES ATTNMSSYDS EAPLEDDFSD TSLKLGLPYW E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A9e-17269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B9e-17269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C9e-17269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D9e-17269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A1e-16269168Myocyte-specific enhancer factor 2A
3kov_B1e-16269168Myocyte-specific enhancer factor 2A
3kov_I1e-16269168Myocyte-specific enhancer factor 2A
3kov_J1e-16269168Myocyte-specific enhancer factor 2A
3p57_A1e-16269168Myocyte-specific enhancer factor 2A
3p57_B1e-16269168Myocyte-specific enhancer factor 2A
3p57_C1e-16269168Myocyte-specific enhancer factor 2A
3p57_D1e-16269168Myocyte-specific enhancer factor 2A
3p57_I1e-16269168Myocyte-specific enhancer factor 2A
3p57_J1e-16269168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0051580.0AF005158.1 Arabidopsis thaliana MADS-box Protein (AGL24) mRNA, complete cds.
GenBankBT0251710.0BT025171.1 Arabidopsis thaliana At4g24540 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006413417.11e-160hypothetical protein EUTSA_v10026757mg
SwissprotO827941e-137AGL24_ARATH; MADS-box protein AGL24
TrEMBLV4LW031e-160V4LW03_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.7__1822__AT4G24540.11e-137(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM145111521
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24540.11e-119AGAMOUS-like 24